PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009795778.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 1001aa    MW: 109579 Da    PI: 5.6465
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009795778.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29595646152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009795778.1 595 AEKHVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 646
                     5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.188578666IPR003035RWP-RK domain
PfamPF020424.2E-26599646IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22898984No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-24901983No hitNo description
SMARTSM006661.1E-23901983IPR000270PB1 domain
PROSITE profilePS5174520.581901983IPR000270PB1 domain
PfamPF005647.6E-19901982IPR000270PB1 domain
CDDcd064073.54E-33902982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    Send to blast
MERGVGFWAS PRGQMEGVVS FDASARSSNV DDSFNNVMEI MNLDAYTGWC TSPSAAEQMF  60
ASYAAFSQMN SMSQSYAPFE GLSYAEQNTG TFPPMDANMV GSTVCGGEKM MFGQNDEQLH  120
FVVDSTDGVG LVAKRSKNSS QQADDADIGN SMIVRSPSQP LAERMLRALA MFKESSGAGI  180
LAQVWIPMKN KDQYVLSTCE QPYLLDQALS GYREVSRKFT FDAETKPGSI PGLPGRVFSS  240
RIPEWTSNVL YYKEAEYLRV QYAVNHEVRG SIALPVFEDD ACETPCCAVL ELVTMKEKPN  300
FDLEMDHVCR ALQAVNLRSI APPRLHSQTL SKNQRAALAE ITDVLRAVCH AHKLPLALTW  360
IPCSVTEGEG DESIRVLARG CNASSNEKCV LCAEDTACYV SDKEMQGFVH ACMEHYLEEG  420
EGIVGKALQS NHPFFYPDVK EYHISEYPLV HHARKFGLNA AVAIRLRSTF TGNDDYILEF  480
FLPISMKGST EQQLLLNNLS GTMQRICRSL RTVSDAELVG QGATFGLQDG FAPNLPPITL  540
SRRNSQHSLD SNSNSASVAP LGVSDSKSAG MQADGCREQT MIGSRRQMEK KRSTAEKHVS  600
LSVLQQYFSG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVLESV  660
QGVEGGLKFD PATGSLVPAS SIIQDFDAQQ SIFFPCKDVS VKNPNSVFQD AVSVPSTPGI  720
DKENSMVKME EDSYVDGNQL GQSNHINTSS FKGGNKSSIP VSGFCYEPKL AALDAMTSRP  780
ASQTMLLTNS RNASLGSFHT KEGCRRWGLD NDTMDNFECH FTSQCSYSKA AGDDGDTKIK  840
GDNEMDGDGG VIEHNQASSS AMTDSSNGSE SMMNGSSSSS RSHGARKHSK VEANFGDSGS  900
TITVKATYKE DTTRFKFEPS AGCFQLYEEV AKRFKLQTGT FQLKYLDDEE EWVMLVNDAD  960
LHECLEILDF VGGRTIKFLV RDTPYAMGSS GSSNCFLASG S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795771.10.0PREDICTED: protein NLP9-like
RefseqXP_009795773.10.0PREDICTED: protein NLP9-like
RefseqXP_009795774.10.0PREDICTED: protein NLP9-like
RefseqXP_009795775.10.0PREDICTED: protein NLP9-like
RefseqXP_009795776.10.0PREDICTED: protein NLP9-like
RefseqXP_009795777.10.0PREDICTED: protein NLP9-like
RefseqXP_009795778.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLK4D8J90.0K4D8J9_SOLLC; Uncharacterized protein
STRINGSolyc11g045350.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein